QPRT (NM_014298) Human Mass Spec Standard
CAT#: PH302960
QPRT MS Standard C13 and N15-labeled recombinant protein (NP_055113)
View other "QPRT" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | QPRT MS Standard C13 and N15-labeled recombinant protein (NP_055113) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC202960 | 
| Predicted MW | 30.8 kDa | 
| Protein Sequence | 
                 >RC202960 protein sequence 
Red=Cloning site Green=Tags(s) MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGILAGQPFFDAIFTQLNCQ VSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKT TPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGGVEKAVRAARQAADFALKVEVECSSLQEAVQ AAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD FSLKLFAKEVAPVPKIH myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_055113 | 
| RefSeq Size | 1575 | 
| RefSeq ORF | 891 | 
| Synonyms | HEL-S-90n; QPRTase | 
| Locus ID | 23475 | 
| Cytogenetics | 16p11.2 | 
| Summary | This gene encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimer's disease, and Huntington's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] | 
| Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402307 | QPRT HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY402307 | Transient overexpression lysate of quinolinate phosphoribosyltransferase (QPRT) | 
                                                     CNY 3080.00  | 
                                            |
| TP302960 | Recombinant protein of human quinolinate phosphoribosyltransferase (QPRT), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP720230 | Recombinant protein of human quinolinate phosphoribosyltransferase (QPRT) | 
                                                     CNY 1800.00  | 
                                            
