SPSB2 (NM_032641) Human Mass Spec Standard
CAT#: PH300801
SPSB2 MS Standard C13 and N15-labeled recombinant protein (NP_116030)
View other "SPSB2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SPSB2 MS Standard C13 and N15-labeled recombinant protein (NP_116030) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200801 |
| Predicted MW | 28.6 kDa |
| Protein Sequence |
>RC200801 protein sequence
Red=Cloning site Green=Tags(s) MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRP VAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKL YHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQC QVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116030 |
| RefSeq Size | 1272 |
| RefSeq ORF | 789 |
| Synonyms | GRCC9; SSB2 |
| Locus ID | 84727 |
| Cytogenetics | 12p13.31 |
| Summary | This gene encodes a member of a subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal suppressor of cytokine signaling (SOCS) box. This protein plays a role in cell signaling. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409988 | SPSB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431815 | SPSB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409988 | Transient overexpression lysate of splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2), transcript variant 1 |
CNY 3080.00 |
|
| LY431815 | Transient overexpression lysate of splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2), transcript variant 2 |
CNY 3080.00 |
|
| TP300801 | Recombinant protein of human splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2), 20 µg |
CNY 2900.00 |

