SPSB2 Rabbit Polyclonal Antibody
CAT#: TA343000
Rabbit Polyclonal Anti-SPSB2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | IHC, WB |
| Reactivity | Human, Rhesus macaque |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the N terminal of human SPSB2. Synthetic peptide located within the following region: KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 28 kDa |
| Gene Name | splA/ryanodine receptor domain and SOCS box containing 2 |
| Database Link | |
| Background | This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. |
| Synonyms | GRCC9; SSB2 |
| Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Zebrafish: 79% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |

