CD70 (NM_001252) Human Mass Spec Standard
CAT#: PH300410
CD70 MS Standard C13 and N15-labeled recombinant protein (NP_001243)
View other "CD70" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CD70 MS Standard C13 and N15-labeled recombinant protein (NP_001243) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200410 |
| Predicted MW | 21.1 kDa |
| Protein Sequence |
>RC200410 protein sequence
Red=Cloning site Green=Tags(s) MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQD PRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSI SLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001243 |
| RefSeq Size | 913 |
| RefSeq ORF | 579 |
| Synonyms | CD27-L; CD27L; CD27LG; LPFS3; TNFSF7; TNLG8A |
| Locus ID | 970 |
| Cytogenetics | 19p13.3 |
| Summary | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008] |
| Protein Families | ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400501 | CD70 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400501 | Transient overexpression lysate of CD70 molecule (CD70) |
CNY 3080.00 |
|
| TP300410 | Recombinant protein of human CD70 molecule (CD70), 20 µg |
CNY 2900.00 |
|
| TP700287 | Purified recombinant protein of human CD70 molecule (CD70), with C-terminal Fc tag, expressed in human cells, 20 µg |
CNY 6650.00 |
|
| TP723962 | Human CD70 Protein, mFc-His Tag |
CNY 5249.00 |
|
| TP724019 | Human CD70 Protein, hFc-His Tag |
CNY 5249.00 |

