E7 (NC_001526) Virus Tagged ORF Clone
CAT#: VC101903
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for transforming protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041326
View other clones from "Virus" (7)
Need custom modification / cloning service?
Get a free quote
CNY 1800.00
Cited in 1 publication. |
Product images

CNY 600.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101903 represents NCBI reference of NP_041326 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCACGGCGACACCCCCACTCTTCACGAATATATGCTGGATCTGCAGCCAGAAACAACCGATCTTTACT GCTATGAACAGCTGAATGACTCATCAGAAGAAGAGGACGAGATCGATGGCCCAGCGGGCCAAGCCGAGCC AGATCGCGCTCATTACAATATTGTGACTTTCTGTTGCAAGTGTGATTCAACACTGCGCCTGTGTGTGCAA TCCACTCACGTAGATATTAGAACATTGGAGGACCTGCTCATGGGCACACTGGGAATCGTGTGTCCCATCT GTTCCCAAAAGCCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101903 representing NP_041326
Red=Cloning sites Green=Tags MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQ STHVDIRTLEDLLMGTLGIVCPICSQKP TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001526 |
ORF Size | 294 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_001526.2, NP_041326 |
RefSeq ORF | 294 bp |
Locus ID | 1489079 |
UniProt ID | P03120 |
MW | 11.0 kDa |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Comparative Proteomics Reveals Strain-Specific ß-TrCP Degradation via Rotavirus NSP1 Hijacking a Host Cullin-3-Rbx1 Complex
,Ding, S;Mooney, N;Li, B;Kelly, MR;Feng, N;Loktev, AV;Sen, A;Patton, JT;Jackson, PK;Greenberg, HB;,
PLoS Pathog.
,PubMed ID 27706223
[E7]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101899 | Myc-DDK-tagged ORF clone of viral ORF for E1 [Human papillomavirus type 16], codon optimized for human cell expression, NP_041327 |
CNY 5312.00 |
|
VC101900 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HpV16gp5, partial [Human papillomavirus type 16], codon optimized for human cell expression, NP_041329 |
CNY 1320.00 |
|
VC101901 | Myc-DDK-tagged ORF clone of viral ORF for E5 protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041330 |
CNY 1320.00 |
|
VC101902 | Myc-DDK-tagged ORF clone of viral ORF for transforming protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041325 |
CNY 1800.00 |
|
VC101904 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041328 |
CNY 5488.00 |
|
VC101905 | Myc-DDK-tagged ORF clone of viral ORF for minor capsid protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041331 |
CNY 5488.00 |
|
VC101906 | Myc-DDK-tagged ORF clone of viral ORF for major capsid L1 protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041332 |
CNY 5928.00 |