E6 (NC_001526) Virus Tagged ORF Clone

CAT#: VC101902

  • TrueORF®

Myc-DDK-tagged ORF clone of viral ORF for transforming protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041325



  View other clones from "Virus" (7)

Need custom modification / cloning service?
Get a free quote

CNY 1800.00


货期*
现货

规格
    • 10 ug

Cited in 1 publication.

Product images

推荐一起购买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1280.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Type Virus Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC101902 represents NCBI reference of NP_041325 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACCAGAAACGAACCGCTATGTTTCAGGATCCTCAGGAGAGACCTCGCAAGCTCCCTCAGCTGTGCA
CTGAGCTCCAGACGACCATTCACGATATCATCCTTGAGTGTGTGTATTGTAAACAGCAGCTGCTGAGACG
GGAAGTGTACGATTTCGCTTTCAGGGACCTCTGCATAGTCTACAGGGACGGAAACCCTTACGCCGTGTGC
GACAAATGTCTGAAATTCTACTCCAAAATCTCTGAATATAGGCACTATTGTTACTCACTTTATGGAACAA
CCCTGGAGCAGCAATATAATAAGCCTCTTTGCGACCTGCTGATTCGGTGCATCAATTGCCAGAAACCGCT
CTGTCCAGAGGAGAAGCAGAGGCACCTGGACAAAAAACAGAGGTTTCATAATATACGGGGGCGGTGGACA
GGCAGGTGTATGAGCTGCTGTCGGAGTAGTCGAACAAGAAGGGAGACCCAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC101902 representing NP_041325
Red=Cloning sites Green=Tags

MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVC
DKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWT
GRCMSCCRSSRTRRETQL

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_001526
ORF Size 474 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NC_001526.2, NP_041325
RefSeq ORF 474 bp
Locus ID 1489078
UniProt ID P03120
MW 19.2 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...