Ube2i (BC037635) Mouse Tagged ORF Clone
CAT#: MR200308
- TrueORF®
Ube2i (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2I (cDNA clone MGC:46871 IMAGE:4951933)
ORF Plasmid: tGFP
"BC037635" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1200.00
CNY 2945.00
| Cited in 2 publications. |
CNY 300.00
CNY 6840.00
Specifications
| Product Data | |
| Type | Mouse Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | Mmubc9, UBC9, 5830467E05Rik |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>MR200308 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCGGGGATCGCCCTCAGCCGCCTTGCGCAGGAAAGGAAAGCCTGGAGGAAGGACCACCCTTTTGGCT TTGTAGCTGTCCCAACAAAGAACCCTGATGGCACAATGAACCTGATGAACTGGGAGTGCGCTATCCCTGG AAAGAAGGGGACTCCATGGGAAGGAGGCTTGTTCAAGCTACGGATGCTTTTCAAAGATGACTATCCGTCC TCACCACCAAAATGTAAGTTGTGCAAAGAGCCTGCAGTCCACTTCCCAGCACTACCACCACCCTTTGGGA GCCATGTCTGTGAGTGCTTGGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200308 protein sequence
Red=Cloning site Green=Tags(s) MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPS SPPKCKLCKEPAVHFPALPPPFGSHVCECLA myc-FLAG tag |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | BC037635 |
| ORF Size | 303 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | BC037635, AAH37635 |
| RefSeq Size | 2252 bp |
| RefSeq ORF | 305 bp |
| Locus ID | 22196 |
| MW | 11.2 kDa |
| Gene Summary | Accepts the ubiquitin-like proteins SUMO1, SUMO2 and SUMO3 from the UBLE1A-UBLE1B E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as RANBP2, CBX4 and ZNF451. Can catalyze the formation of poly-SUMO chains. Essential for nuclear architecture, chromosome segregation and embryonic viability. Necessary for sumoylation of FOXL2 and KAT5 (By similarity). Sumoylates p53/TP53 at 'Lys-386'.[UniProtKB/Swiss-Prot Function] |
Citations (2)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
SUMOylation Regulates Insulin Exocytosis Downstream of Secretory Granule Docking in Rodents and Humans
,null,
Diabetes
,PubMed ID 21266332
[Ube2i]
|
|
SUMOylation regulates Kv2.1 and modulates pancreatic beta-cell excitability.
,null,
Journal of cell science
,PubMed ID 19223394
[Ube2i]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| MC206861 | Ube2i (untagged) - Mouse ubiquitin-conjugating enzyme E2I (cDNA clone MGC:46871 IMAGE:4951933), (10ug) |
CNY 3230.00 |
|
| MG200308 | Ube2i (tGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2I (cDNA clone MGC:46871 IMAGE:4951933) |
CNY 2850.00 |
|
| MR200308L3 | Lenti ORF clone of Ube2i (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2I (cDNA clone MGC:46871 IMAGE:4951933) |
CNY 4750.00 |
|
| MR200308L4 | Lenti ORF clone of Ube2i (mGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2I (cDNA clone MGC:46871 IMAGE:4951933) |
CNY 4750.00 |
