PRMT6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	10k-ChIP, WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRMT6 antibody: synthetic peptide directed towards the middle region of human PRMT6. Synthetic peptide located within the following region: FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	protein arginine methyltransferase 6
Database Link	NP_060607 Entrez Gene 55170 Human UniProt ID Q96LA8
Background	Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine. [supplied by OMIM]
Synonyms	HRMT1L6
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.