PRMT6 (NM_018137) Human Recombinant Protein
CAT#: TP329177
Recombinant protein of human protein arginine methyltransferase 6 (PRMT6), 20 µg
View other "PRMT6" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC229177 representing NM_018137
Red=Cloning site Green=Tags(s) MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAY RLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPV ETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQ VKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCY GSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNP RRLRVLLRYKVGDQEEKTKDFAMED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060607 |
| Locus ID | 55170 |
| UniProt ID | Q96LA8 |
| Cytogenetics | 1p13.3 |
| Refseq ORF | 1125 |
| Synonyms | HRMT1L6 |
| Summary | The protein encoded by this gene belongs to the arginine N-methyltransferase family, which catalyze the sequential transfer of methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins, to form methylated arginine derivatives and S-adenosyl-L-homocysteine. This protein can catalyze both, the formation of omega-N monomethylarginine and asymmetrical dimethylarginine, with a strong preference for the latter. It specifically mediates the asymmetric dimethylation of Arg2 of histone H3, and the methylated form represents a specific tag for epigenetic transcriptional repression. This protein also forms a complex with, and methylates DNA polymerase beta, resulting in stimulation of polymerase activity by enhancing DNA binding and processivity. [provided by RefSeq, Sep 2011] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413290 | PRMT6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432201 | PRMT6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413290 | Transient overexpression lysate of protein arginine methyltransferase 6 (PRMT6) |
CNY 3080.00 |
|
| LY432201 | Transient overexpression lysate of protein arginine methyltransferase 6 (PRMT6) |
CNY 3080.00 |
|
| PH309527 | PRMT6 MS Standard C13 and N15-labeled recombinant protein (NP_060607) |
CNY 19520.00 |
|
| TP309527 | Recombinant protein of human protein arginine methyltransferase 6 (PRMT6), 20 µg |
CNY 2900.00 |
