UCHL5IP (HAUS7) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UCHL5IP antibody: synthetic peptide directed towards the middle region of human UCHL5IP. Synthetic peptide located within the following region: LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	HAUS augmin like complex subunit 7
Database Link	NP_996990 Entrez Gene 55559 Human UniProt ID Q99871
Background	This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom
Synonyms	HSXQ28ORF; UCHL5IP; UIP1
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Pig: 92%; Mouse: 92%; Bovine: 86%; Rabbit: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.