UCHL5IP (HAUS7) (NM_017518) Human Recombinant Protein
CAT#: TP303737
Recombinant protein of human UCHL5 interacting protein (UCHL5IP), transcript variant 1, 20 µg
View other "UCHL5IP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203737 protein sequence
Red=Cloning site Green=Tags(s) MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCS PSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFM DQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDW QWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLIL AFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWG GSSSVMSLATKMNELMEK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_059988 |
| Locus ID | 55559 |
| UniProt ID | Q99871 |
| Refseq Size | 1378 |
| Cytogenetics | Xq28 |
| Refseq ORF | 1104 |
| Synonyms | UCHL5IP; UIP1 |
| Summary | This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413731 | HAUS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413731 | Transient overexpression lysate of HAUS augmin-like complex, subunit 7 (HAUS7) |
CNY 3080.00 |
|
| PH303737 | HAUS7 MS Standard C13 and N15-labeled recombinant protein (NP_059988) |
CNY 19520.00 |
其它UCHL5IP产品
