GPR56 (ADGRG1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GPR56 antibody: synthetic peptide directed towards the N terminal of human GPR56. Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	adhesion G protein-coupled receptor G1
Database Link	NP_005673 Entrez Gene 9289 Human UniProt ID Q9Y653
Background	GPR56 could be involved in cell-cell interactions.
Synonyms	BFPP; BPPR; GPR56; TM7LN4; TM7XN1
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Rat: 79%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.