GPR56 (ADGRG1) (NM_005682) Human Recombinant Protein
CAT#: TP300315
Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 1, 20 µg
View other "GPR56" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200315 protein sequence
Red=Cloning site Green=Tags(s) MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAP FPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSV TSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQ SLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGR SGEAEKRLLLVDFSSQALFQDKNSSHVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWV EDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLV TIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCL SWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPS MCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSF ASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 75 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005673 |
| Locus ID | 9289 |
| UniProt ID | Q9Y653 |
| Refseq Size | 3831 |
| Cytogenetics | 16q21 |
| Refseq ORF | 2079 |
| Synonyms | BFPP; BPPR; GPR56; TM7LN4; TM7XN1 |
| Summary | This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401733 | ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404437 | ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428998 | ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401733 | Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 1 |
CNY 3080.00 |
|
| LY404437 | Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 2 |
CNY 4840.00 |
|
| LY428998 | Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 4 |
CNY 4840.00 |
|
| PH300315 | GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_005673) |
CNY 19520.00 |
|
| PH318780 | GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_958932) |
CNY 19520.00 |
|
| PH326861 | GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_001139243) |
CNY 19520.00 |
|
| TP318780 | Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326861 | Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 4, 20 µg |
CNY 2900.00 |


