Tcl1 (TCL1A) Rabbit Polyclonal Antibody
CAT#: TA344195
Rabbit Polyclonal Anti-TCL1A Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TCL1A antibody: synthetic peptide directed towards the N terminal of human TCL1A. Synthetic peptide located within the following region: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 13 kDa |
Gene Name | T-cell leukemia/lymphoma 1A |
Database Link | |
Background | TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3;promote nuclear translocation of AKT1;enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival. |
Synonyms | TCL1 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |