IRAKM (IRAK3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IRAK3 antibody: synthetic peptide directed towards the C terminal of human IRAK3. Synthetic peptide located within the following region: NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	interleukin 1 receptor associated kinase 3
Database Link	NP_009130 Entrez Gene 11213 Human UniProt ID Q9Y616
Background	IRAK3 contains 1 protein kinase domain and 1 death domain and belongs to the Ser/Thr protein kinase family, Pelle subfamily. It inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.
Synonyms	ASRT5; IRAKM
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	Apoptosis, Neurotrophin signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.