IRAKM (IRAK3) (NM_007199) Human Recombinant Protein
CAT#: TP309245
Recombinant protein of human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1, 20 µg
View other "IRAKM" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209245 protein sequence
Red=Cloning site Green=Tags(s) MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEKYVDQGKSGTR ELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIP EHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVYRVEIQNLTYAVKLFKQEKKMQCKKHWKRFL SELEVLLLFHHPNILELAAYFTETEKFCLIYPYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHY LHNVQPCSVICGSISSANILLDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGK LSIKTDVYSFGIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL PSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVN IDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 67.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_009130 |
| Locus ID | 11213 |
| UniProt ID | Q9Y616 |
| Refseq Size | 8351 |
| Cytogenetics | 12q14.3 |
| Refseq ORF | 1788 |
| Synonyms | ASRT5; IRAKM |
| Summary | This gene encodes a member of the interleukin-1 receptor-associated kinase protein family. Members of this family are essential components of the Toll/IL-R immune signal transduction pathways. This protein is primarily expressed in monocytes and macrophages and functions as a negative regulator of Toll-like receptor signaling. Mutations in this gene are associated with a susceptibility to asthma. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Apoptosis, Neurotrophin signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402105 | IRAK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428144 | IRAK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402105 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1 |
CNY 3080.00 |
|
| LY428144 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 2 |
CNY 3080.00 |
|
| PH309245 | IRAK3 MS Standard C13 and N15-labeled recombinant protein (NP_009130) |
CNY 19520.00 |
