INCA (CARD17) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CARD17 antibody: synthetic peptide directed towards the middle region of human CARD17. Synthetic peptide located within the following region: MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	12 kDa
Gene Name	caspase recruitment domain family member 17
Database Link	NP_001007233 Entrez Gene 440068 Human UniProt ID Q5XLA6
Background	As a regulator of procaspase-1/CASP1 activation, CARD17 is implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. CARD17 inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, CARD17 do not induce NF-kappa-B activation.
Synonyms	INCA
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.