INCA (CARD17) (NM_001007232) Human Recombinant Protein
CAT#: TP324934
Recombinant protein of human caspase recruitment domain family, member 17 (CARD17), 20 µg
View other "INCA" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224934 representing NM_001007232
Red=Cloning site Green=Tags(s) MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQ ICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 11.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001007233 |
| Locus ID | 440068 |
| UniProt ID | Q5XLA6 |
| Refseq Size | 466 |
| Cytogenetics | 11q22.3 |
| Refseq ORF | 330 |
| Synonyms | INCA |
| Summary | Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423457 | CARD17 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423457 | Transient overexpression lysate of caspase recruitment domain family, member 17 (CARD17) |
CNY 3080.00 |
|
| PH324934 | CARD17 MS Standard C13 and N15-labeled recombinant protein (NP_001007233) |
CNY 14250.00 |
