CERKL Rabbit Polyclonal Antibody
CAT#: TA342754
Rabbit Polyclonal Anti-CERKL Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CERKL antibody: synthetic peptide directed towards the C terminal of human CERKL. Synthetic peptide located within the following region: ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 51 kDa |
Gene Name | ceramide kinase like |
Database Link | |
Background | This gene was initially identified as a locus (RP26) associated with an autosomal recessive form of retinitis pigmentosa (arRP) disease. This gene encodes a protein with ceramide kinase-like domains, however, the protein does not phosphorylate ceramide and its target substrate is currently unknown. This protein may be a negative regulator of apoptosis in photoreceptor cells. Mutations in this gene cause a form of retinitis pigmentosa characterized by autosomal recessive cone and rod dystrophy (arCRD). Alternative splicing of this gene results in multiple transcript variants encoding different isoforms and non-coding transcripts. |
Synonyms | RP26 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 90%; Yeast: 89%; Rabbit: 81%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Zebrafish: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |