SNAI3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Snai3 antibody: synthetic peptide directed towards the n terminal of mouse Snai3. Synthetic peptide located within the following region: MPRSFLVKTHSSHRVPNYGKLETLREANGSCSACKELAGSRHLPDEEAPC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	snail family transcriptional repressor 3
Database Link	NP_840101 Entrez Gene 30927 MouseEntrez Gene 333929 Human UniProt ID Q3KNW1
Background	Snai3 seems to inhibit myoblast differentiation. Snai3 is a transcriptional repressor of E-box-dependent transactivation of downstream myogenic bHLHs genes. Snai3 binds preferentially to the canonical E-box sequences 5'-CAGGTG-3' and 5'-CACCTG-3'.
Synonyms	SMUC; SNAIL3; Zfp293; ZNF293
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Bovine: 93%; Human: 86%; Rabbit: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.