SNAI3 (NM_178310) Human Recombinant Protein
CAT#: TP313897
Recombinant protein of human snail homolog 3 (Drosophila) (SNAI3), 20 µg
View other "SNAI3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213897 representing NM_178310
Red=Cloning site Green=Tags(s) MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISL PLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLL GAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCT CKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLL ARHEESGCCPGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_840101 |
Locus ID | 333929 |
UniProt ID | Q3KNW1 |
Refseq Size | 1630 |
Cytogenetics | 16q24.2 |
Refseq ORF | 876 |
Synonyms | SMUC; SNAIL3; Zfp293; ZNF293 |
Summary | SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis (Katoh and Katoh, 2003 [PubMed 12579345]).[supplied by OMIM, Apr 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405994 | SNAI3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405994 | Transient overexpression lysate of snail homolog 3 (Drosophila) (SNAI3) |
CNY 3080.00 |
|
PH313897 | SNAI3 MS Standard C13 and N15-labeled recombinant protein (NP_840101) |
CNY 19520.00 |
|
TP761526 | Purified recombinant protein of Human snail homolog 3 (Drosophila) (SNAI3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |