ZNF397 Rabbit Polyclonal Antibody

CAT#: TA341412

Rabbit Polyclonal Anti-ZNF397 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human zinc finger protein 397 (ZNF397), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of zinc finger protein 397 (ZNF397), transcript variant 2
    • 100 ug

CNY 3080.00


Transient overexpression lysate of zinc finger protein 397 (ZNF397), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF397 antibody: synthetic peptide directed towards the middle region of human ZNF397. Synthetic peptide located within the following region: VQQHNPESGEEAVTLLEDLEREFDDPGQQVPASPQGPAVPWKDLTCLRAS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 61 kDa
Gene Name zinc finger protein 397
Background This gene encodes a protein with a N-terminal SCAN domain, andThe longer isoform contains nine C2H2-type zinc finger repeats inThe C-terminal domain.The protein localizes to centromeres during interphase and early prophase, and different isoforms can repress or activate transcription in transfection studies. Multiple transcript variants encoding different isoforms have been found forThis gene. Additional variants have been described, butTheir biological validity has not been determined. [provided by RefSeq, Oct 2009]
Synonyms ZNF47; ZSCAN15
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Rat: 92%; Mouse: 92%; Dog: 75%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...