ZNF397 (NM_032347) Human Recombinant Protein
CAT#: TP303025
Recombinant protein of human zinc finger protein 397 (ZNF397), transcript variant 2, 20 µg
View other "ZNF397" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203025 protein sequence
Red=Cloning site Green=Tags(s) MAVESGVISTLIPQDPPEQELILVKVEDNFSWDEKFKQNGSTQSCQELFRQQFRKFCYQETPGPREALSR LQELCYQWLMPELHTKEQILELLVLEQFLSILPEELQIWVQQHNPESGEEAVTLLEDLEREFDDPGQQVP ASPQGPAVPWKDLTCLRASQESTDIHLQPLKTQLKSWKPCLSPKSDCENSETATKEGISEEKSQGLPQEP SFRGIKLSRPPKASSAIRWECVSPGSFPGDIIAAEATHSTISCFAINTLPATILPSKNVNRKYFS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115723 |
Locus ID | 84307 |
UniProt ID | Q8NF99 |
Refseq Size | 1494 |
Cytogenetics | 18q12.2 |
Refseq ORF | 825 |
Synonyms | ZNF47; ZSCAN15 |
Summary | This gene encodes a protein with a N-terminal SCAN domain, and the longer isoform contains nine C2H2-type zinc finger repeats in the C-terminal domain. The protein localizes to centromeres during interphase and early prophase, and different isoforms can repress or activate transcription in transfection studies. Multiple transcript variants encoding different isoforms have been found for this gene. Additional variants have been described, but their biological validity has not been determined. [provided by RefSeq, Oct 2009] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410184 | ZNF397 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427576 | ZNF397 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410184 | Transient overexpression lysate of zinc finger protein 397 (ZNF397), transcript variant 2 |
CNY 3080.00 |
|
LY427576 | Transient overexpression lysate of zinc finger protein 397 (ZNF397), transcript variant 1 |
CNY 3080.00 |
|
PH303025 | ZNF397 MS Standard C13 and N15-labeled recombinant protein (NP_115723) |
CNY 19520.00 |