BNIPL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BNIPL antibody: synthetic peptide directed towards the middle region of human BNIPL. Synthetic peptide located within the following region: AENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	BCL2/adenovirus E1B 19kD interacting protein like
Database Link	NP_612122 Entrez Gene 149428 Human UniProt ID Q7Z465
Background	BNIPL may be a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death.
Synonyms	BNIP-S; BNIP-Salpha; BNIP-Sbeta; BNIPL-1; BNIPL-2; BNIPL1; BNIPL2; BNIPS; PP753
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.