BNIPL (NM_138278) Human Recombinant Protein
CAT#: TP306811
Recombinant protein of human BCL2/adenovirus E1B 19kD interacting protein like (BNIPL), 20 µg
View other "BNIPL" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206811 protein sequence
Red=Cloning site Green=Tags(s) MGTIQEAGKKTDVGVREIAEAPELGAALRHGELELKEEWQDEEFPRLLPEEAGTSEDPEDPKGDSQAAAG TPSTLALCGQRPMRKRLSAPELRLSLTKGPGNDGASPTQSAPSSPDGSSDLEIDELETPSDSEQLDSGHE FEWEDELPRAEGLGTSETAERLGRGCMWDVTGEDGHHWRVFRMGPREQRVDMTVIEPYKKVLSHGGYHGD GLNAVILFASCYLPRSSIPNYTYVMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRT LDRRLRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRD LHGSGGT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_612122 |
| Locus ID | 149428 |
| UniProt ID | Q7Z465 |
| Refseq Size | 2160 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 1071 |
| Synonyms | BNIP-S; BNIP-Salpha; BNIP-Sbeta; BNIPL-1; BNIPL-2; BNIPL1; BNIPL2; BNIPS; PP753 |
| Summary | The protein encoded by this gene interacts with several other proteins, such as BCL2, ARHGAP1, MIF and GFER. It may function as a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408738 | BNIPL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408738 | Transient overexpression lysate of BCL2/adenovirus E1B 19kD interacting protein like (BNIPL), transcript variant 1 |
CNY 3080.00 |
|
| PH306811 | BNIPL MS Standard C13 and N15-labeled recombinant protein (NP_612122) |
CNY 19520.00 |
