NCE2 (UBE2F) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UBE2F antibody: synthetic peptide directed towards the middle region of human UBE2F. Synthetic peptide located within the following region: TLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	ubiquitin conjugating enzyme E2 F (putative)
Database Link	NP_542409 Entrez Gene 140739 Human UniProt ID Q969M7
Background	UBE2F belongs to the ubiquitin-conjugating enzyme family. UBE2F accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins.
Synonyms	NCE2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 79%
Reference Data
Protein Pathways	Ubiquitin mediated proteolysis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.