TIRAP Rabbit Polyclonal Antibody

CAT#: TA338811

Rabbit Polyclonal Anti-TIRAP Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3, 20 µg
    • 20 ug

CNY 2900.00


Transient overexpression lysate of toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TIRAP antibody: synthetic peptide directed towards the middle region of human TIRAP. Synthetic peptide located within the following region: LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 25 kDa
Gene Name toll-interleukin 1 receptor (TIR) domain containing adaptor protein
Background The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleuk
Synonyms BACTS1; Mal; MyD88-2; wyatt
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Toll-like receptor signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...