TIRAP (NM_001039661) Human Recombinant Protein
CAT#: TP307162
Recombinant protein of human toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3, 20 µg
View other "TIRAP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207162 protein sequence
Red=Cloning site Green=Tags(s) MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLP PTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSS HCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVK EAVMRYLQTLSWHLLYHGTPEIGVKLETENPCRASDSHKCDKRYRE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001034750 |
| Locus ID | 114609 |
| UniProt ID | P58753 |
| Refseq Size | 2348 |
| Cytogenetics | 11q24.2 |
| Refseq ORF | 768 |
| Synonyms | BACTS1; Mal; MyD88-2; wyatt |
| Summary | The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleukin 1 receptor (TIR) domain, which is responsible for signal transduction. The protein encoded by this gene is a TIR adaptor protein involved in the TLR4 signaling pathway of the immune system. It activates NF-kappa-B, MAPK1, MAPK3 and JNK, which then results in cytokine secretion and the inflammatory response. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Toll-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422104 | TIRAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422104 | Transient overexpression lysate of toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3 |
CNY 3080.00 |
|
| PH307162 | TIRAP MS Standard C13 and N15-labeled recombinant protein (NP_001034750) |
CNY 19520.00 |
