IGFBP4 Rabbit Polyclonal Antibody

CAT#: TA338268

Rabbit Polyclonal Anti-IGFBP4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of insulin-like growth factor binding protein 4 (IGFBP4)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human insulin-like growth factor binding protein 4 (IGFBP4), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human insulin-like growth factor binding protein 4 (IGFBP4), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-IGFBP4 antibody: synthetic peptide directed towards the middle region of human IGFBP4. Synthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 26 kDa
Gene Name insulin like growth factor binding protein 4
Background This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq, Jul 2008]
Synonyms BP-4; HT29-IGFBP; IBP4; IGFBP-4
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%
Reference Data
Protein Families Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...