IGFBP4 (NM_001552) Human Recombinant Protein
CAT#: TP304188
Recombinant protein of human insulin-like growth factor binding protein 4 (IGFBP4), 20 µg
View other "IGFBP4" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204188 protein sequence
Red=Cloning site Green=Tags(s) MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVY TPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQ KHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNF HPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001543 |
| Locus ID | 3487 |
| UniProt ID | P22692 |
| Refseq Size | 2246 |
| Cytogenetics | 17q21.2 |
| Refseq ORF | 774 |
| Synonyms | BP-4; HT29-IGFBP; IBP4; IGFBP-4 |
| Summary | This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419861 | IGFBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419861 | Transient overexpression lysate of insulin-like growth factor binding protein 4 (IGFBP4) |
CNY 3080.00 |
|
| PH304188 | IGFBP4 MS Standard C13 and N15-labeled recombinant protein (NP_001543) |
CNY 19520.00 |
|
| TP720301 | Recombinant protein of human insulin-like growth factor binding protein 4 (IGFBP4) |
CNY 1800.00 |
