LILRA3 Rabbit Polyclonal Antibody

CAT#: TA338121

Rabbit Polyclonal Anti-LILRA3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3)
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-LILRA3 antibody is: synthetic peptide directed towards the C-terminal region of Human LILRA3. Synthetic peptide located within the following region: AHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 45 kDa
Gene Name leukocyte immunoglobulin like receptor A3
Background Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function. LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3) lacks a transmembrane region and is presumed to be a soluble receptor.
Synonyms CD85E; HM31; HM43; ILT-6; ILT6; LIR-4; LIR4
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%
Reference Data
Protein Families Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...