LILRA3 (NM_006865) Human Recombinant Protein
CAT#: TP307003
Recombinant protein of human leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), 20 µg
View other "LILRA3" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207003 protein sequence
Red=Cloning site Green=Tags(s) MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWI TRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGN VTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSL PSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQA NFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQG GMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS GAAETLSPPQNKSDSKAGE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006856 |
Locus ID | 11026 |
UniProt ID | Q8N6C8 |
Refseq Size | 1608 |
Cytogenetics | 19q13.4 |
Refseq ORF | 1317 |
Synonyms | CD85E; HM31; HM43; ILT-6; ILT6; LIR-4; LIR4 |
Summary | This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. [provided by RefSeq, Mar 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416372 | LILRA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432960 | LILRA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416372 | Transient overexpression lysate of leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3) |
CNY 3080.00 |
|
LY432960 | Transient overexpression lysate of leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), transcript variant 2 |
CNY 3080.00 |
|
PH307003 | LILRA3 MS Standard C13 and N15-labeled recombinant protein (NP_006856) |
CNY 19520.00 |
|
TP721110 | Purified recombinant protein of Human leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), transcript variant 1 |
CNY 1800.00 |