OS9 Rabbit Polyclonal Antibody

CAT#: TA335671

Rabbit Polyclonal Anti-OS9 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of osteosarcoma amplified 9, endoplasmic reticulum lectin (OS9), transcript variant 1
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human osteosarcoma amplified 9, endoplasmic reticulum associated protein (OS9), transcript variant 4, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human osteosarcoma amplified 9, endoplasmic reticulum associated protein (OS9), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-OS9 Antibody is: synthetic peptide directed towards the C-terminal region of Human OS9. Synthetic peptide located within the following region: LKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPGGEGTGDLDEFDF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 73 kDa
Gene Name OS9, endoplasmic reticulum lectin
Background This gene encodes a protein that is highly expressed in osteosarcomas. This protein binds to the hypoxia-inducible factor 1 (HIF-1), a key regulator of the hypoxic response and angiogenesis, and promotes the degradation of one of its subunits. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Synonyms ERLEC2; OS-9
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 86%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...