OS9 (NM_001017958) Human Recombinant Protein
CAT#: TP316820
Recombinant protein of human osteosarcoma amplified 9, endoplasmic reticulum associated protein (OS9), transcript variant 4, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216820 representing NM_001017958
Red=Cloning site Green=Tags(s) MAAETLLSSLLGLLLLGLLLPASLTGGVGSLNLEELSEMRYGIEILPLPVMGGQSQSSDVVIVSSKYKQR YECRLPAGAIHFQREREEETPAYQGPGIPELLSPMRDAPCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKG EVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRV DEPLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLG PQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDF QNNVQVKVIRSPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDED EDEDEDEDERQLLGEFEKELEGILLPSDRDRLRSETEKELDPDGLKKESERDRAMLALTSTLNKLIKRLE EKQSPELVKKHKKKRVVPKKPPPSPQPTEEDPEHRVRVRVTKLRLGGPNQDLTVLEMKRENPQLKQIEGL VKELLEREGLTAAGKIEIKIVRPWAEGTEEGARWLTDEDTRNLKEIFFNILVPGAEEAQKERQRQKELES NYRRVWGSPGGEGTGDLDEFDF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 71.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001017958 |
| Locus ID | 10956 |
| UniProt ID | Q13438 |
| Refseq Size | 2676 |
| Cytogenetics | 12q13.3-q14.1 |
| Refseq ORF | 1956 |
| Synonyms | ERLEC2; OS-9 |
| Summary | This gene encodes a protein that is highly expressed in osteosarcomas. This protein binds to the hypoxia-inducible factor 1 (HIF-1), a key regulator of the hypoxic response and angiogenesis, and promotes the degradation of one of its subunits. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Hypoxia Associated Proteolytic Processing of OS-9 by the Metalloproteinase Meprin β
,null,
International Journal of Nephrology
,PubMed ID 27478637
[OS9]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402037 | OS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422763 | OS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY402037 | Transient overexpression lysate of osteosarcoma amplified 9, endoplasmic reticulum lectin (OS9), transcript variant 1 |
CNY 4840.00 |
|
| LY422763 | Transient overexpression lysate of osteosarcoma amplified 9, endoplasmic reticulum lectin (OS9), transcript variant 4 |
CNY 4840.00 |
|
| PH316820 | OS9 MS Standard C13 and N15-labeled recombinant protein (NP_001017958) |
CNY 19520.00 |
|
| PH318206 | OS9 MS Standard C13 and N15-labeled recombinant protein (NP_006803) |
CNY 19520.00 |
|
| TP318206 | Recombinant protein of human osteosarcoma amplified 9, endoplasmic reticulum associated protein (OS9), transcript variant 1, 20 µg |
CNY 2900.00 |
