TKTL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TKTL1 Antibody: synthetic peptide directed towards the middle region of human TKTL1. Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	transketolase-like 1
Database Link	NP_036385 Entrez Gene 8277 Human UniProt ID P51854
Background	Strong TKTL1 protein expression has been correlated with a certain type of glucose metabolism (aerobic glycolysis; Warburg effect) and to cells which are affected by chronic complications of diabetic patients. In colon and urothelial carcinomas, expression at the protein level is correlated with invasiveness of tumors and poor patient survival.
Synonyms	TKR; TKT2
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 85%; Dog: 83%; Pig: 79%; Guinea pig: 79%; Rat: 77%; Horse: 77%; Rabbit: 77%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Metabolic pathways, Pentose phosphate pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.