TKTL1 Rabbit Polyclonal Antibody
CAT#: TA335653
Rabbit Polyclonal Anti-TKTL1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-TKTL1 Antibody: synthetic peptide directed towards the middle region of human TKTL1. Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 65 kDa |
| Gene Name | transketolase-like 1 |
| Database Link | |
| Background | Strong TKTL1 protein expression has been correlated with a certain type of glucose metabolism (aerobic glycolysis; Warburg effect) and to cells which are affected by chronic complications of diabetic patients. In colon and urothelial carcinomas, expression at the protein level is correlated with invasiveness of tumors and poor patient survival. |
| Synonyms | TKR; TKT2 |
| Note | Immunogen Sequence Homology: Human: 100%; Mouse: 85%; Dog: 83%; Pig: 79%; Guinea pig: 79%; Rat: 77%; Horse: 77%; Rabbit: 77% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pentose phosphate pathway |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
