TKTL1 (NM_012253) Human Recombinant Protein
CAT#: TP305218
Purified recombinant protein of Homo sapiens transketolase-like 1 (TKTL1), 20 µg
View other "TKTL1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205218 protein sequence
Red=Cloning site Green=Tags(s) MADAEARAEFPEEARPDRGTLQVFQDMASRLRIHSIRATCSTSSGHPTSCSSSSEIMSVLFFYIMRYKQS DPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRVFCLMSDGESSEGSVWEAMAF ASYYSLDNLVATFDVNRLGHSGALPAEHCINIYQRRCEAFGWNTYVVDGRDVEALCQVFWQASQVKHKPT AVVAKTFKGRGTPSIEDAESWHAKPMPRERADAIIKLIESQIQTSRNLDPQPPIEDSPEVNITDVRMTSP PDYRVGDKIATRKACGLALAKLGYANNRVVVLDGDTRYSTFSEIFNKEYPERFIECFMAEQNMVSVALGC ASRGRTIAFASTFAAFLTRAFDHIRIGGLAESNINIIGSHCGVSVGDDGASQMALEDIAMFRTIPKCTIF YPTDAVSTEHAVALAANAKGMCFIRTTRPETMVIYTPQERFEIGQAKVLRHCVSDKVTVIGAGITVYEAL AAADELSKQDIFIRVIDLFTIKPLDVATIVSSAKATEGRIITVEDHYPQGGIGEAVCAAVSMDPDIQVHS LAVSGVPQSGKSEELLDMYGISARHIIVAVKCMLLN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 65.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036385 |
| Locus ID | 8277 |
| UniProt ID | P51854 |
| Refseq Size | 2652 |
| Cytogenetics | Xq28 |
| Refseq ORF | 1788 |
| Synonyms | TKR; TKT2 |
| Summary | The protein encoded by this gene is a transketolase that acts as a homodimer and catalyzes the conversion of sedoheptulose 7-phosphate and D-glyceraldehyde 3-phosphate to D-ribose 5-phosphate and D-xylulose 5-phosphate. This reaction links the pentose phosphate pathway with the glycolytic pathway. Variations in this gene may be the cause of Wernicke-Korsakoff syndrome. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pentose phosphate pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415879 | TKTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431505 | TKTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415879 | Transient overexpression lysate of transketolase-like 1 (TKTL1), transcript variant 1 |
CNY 3080.00 |
|
| LY431505 | Transient overexpression lysate of transketolase-like 1 (TKTL1), transcript variant 2 |
CNY 3080.00 |
|
| PH305218 | TKTL1 MS Standard C13 and N15-labeled recombinant protein (NP_036385) |
CNY 14250.00 |
