SOHLH1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SOHLH1 antibody: synthetic peptide directed towards the C terminal of human SOHLH1. Synthetic peptide located within the following region: PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALKD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	spermatogenesis and oogenesis specific basic helix-loop-helix 1
Database Link	NP_001095147 Entrez Gene 402381 Human UniProt ID Q5JUK2
Background	SOHLH1 contains 1 basic helix-loop-helix (bHLH) domain. It is a probable transcription factor required during spermatogenesis and oogenesis.
Synonyms	bA100C15.3; bHLHe80; C9orf157; NOHLH; SPATA27; TEB2
Note	Immunogen Sequence Homology: Human: 100%; Horse: 79%; Yeast: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.