SOHLH1 (NM_001012415) Human Recombinant Protein
CAT#: TP307282
Recombinant protein of human spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1), transcript variant 2, 20 µg
View other "SOHLH1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207282 protein sequence
Red=Cloning site Green=Tags(s) MASRCSEPYPEVSRIPTVRGCNGSLSGALSCCEDSAQGSGPPKAPTVAEGPSSCLRRNVISERERRKRMS LSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILASSKEMWHSLQEDVLQLTLSSQI QAGVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLC QVRGGLPPFSEPSSLVPWPPGRSLPKAVRPPLSWPPFSQQQTLPVMSGEALGWLGQAGSLAMGAAPLGEP AKEDPMLAQEAGSALGSDVDDGTSFLLTAGPSSWPGEWGPGFRAGPPA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001012415 |
| Locus ID | 402381 |
| UniProt ID | Q5JUK2 |
| Refseq Size | 1997 |
| Cytogenetics | 9q34.3 |
| Refseq ORF | 984 |
| Synonyms | bA100C15.3; bHLHe80; C9orf157; NOHLH; ODG5; SPATA27; SPGF32; TEB2 |
| Summary | This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis. This gene is located on chromosome 9. Mutations in this gene are associated with nonobstructive azoospermia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420328 | SOHLH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422853 | SOHLH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420328 | Transient overexpression lysate of spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1), transcript variant 1 |
CNY 3080.00 |
|
| LY422853 | Transient overexpression lysate of spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1), transcript variant 2 |
CNY 3080.00 |
|
| PH307282 | SOHLH1 MS Standard C13 and N15-labeled recombinant protein (NP_001012415) |
CNY 19520.00 |
