PARP3 Rabbit Polyclonal Antibody
CAT#: TA334263
Rabbit Polyclonal Anti-PARP3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PARP3 antibody: synthetic peptide directed towards the C terminal of human PARP3. Synthetic peptide located within the following region: LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 59 kDa |
| Gene Name | poly(ADP-ribose) polymerase family member 3 |
| Database Link | |
| Background | PARP3 belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. PARP3 is preferentially localized to the daughter centriole throughout the cell cycle. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Synonyms | ADPRT3; ADPRTL2; ADPRTL3; ARTD3; IRT1; PADPRT-3 |
| Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 92%; Bovine: 92%; Dog: 91%; Pig: 85%; Mouse: 77% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Base excision repair |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
