FLVCR2 Rabbit Polyclonal Antibody
CAT#: TA331252
Rabbit Polyclonal Anti-FLVCR2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-FLVCR2 antibody is: synthetic peptide directed towards the C-terminal region of Human FLVCR2. Synthetic peptide located within the following region: CVFLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | feline leukemia virus subgroup C cellular receptor family member 2 |
Database Link | |
Background | This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described. |
Synonyms | C14orf58; CCT; EPV; FLVCRL14q; MFSD7C; PVHH |
Note | Human: 100%; Dog: 93%; Pig: 93%; Horse: 86%; Rabbit: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |