FLVCR2 (NM_017791) Human Recombinant Protein
CAT#: TP305665
Recombinant protein of human feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2), 20 µg
View other "FLVCR2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205665 protein sequence
Red=Cloning site Green=Tags(s) MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQPSGLAHPSSS GPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSAFAIDWLSMCYMLTYIPLLLP VAWLLEKFGLRTIALTGSALNCLGAWVKLGSLKPHLFPVTVVGQLICSVAQVFILGMPSRIASVWFGANE VSTACSVAVFGNQLGIAIGFLVPPVLVPNIEDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPP SRAQSLSYALTSPDASYLGSIARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIG LTIVIAGMLGAVISGIWLDRSKTYKETTLVVYIMTLVGMVVYTFTLNLGHLWVVFITAGTMGFFMTGYLP LGFEFAVELTYPESEGISSGLLNISAQVFGIIFTISQGQIIDNYGTKPGNIFLCVFLTLGAALTAFIKAD LRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060261 |
Locus ID | 55640 |
UniProt ID | Q9UPI3 |
Refseq Size | 3669 |
Cytogenetics | 14q24.3 |
Refseq ORF | 1578 |
Synonyms | C14orf58; CCT; EPV; FLVCRL14q; MFSD7C; PVHH; SLC49A2 |
Summary | This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described.[provided by RefSeq, Aug 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413533 | FLVCR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434160 | FLVCR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413533 | Transient overexpression lysate of feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2) |
CNY 3080.00 |
|
LY434160 | Transient overexpression lysate of feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2), transcript variant 2 |
CNY 3080.00 |
|
PH305665 | FLVCR2 MS Standard C13 and N15-labeled recombinant protein (NP_060261) |
CNY 19520.00 |