MRG15 (MORF4L1) Rabbit Polyclonal Antibody
CAT#: TA331185
Rabbit Polyclonal Anti-MORF4L1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MORF4L1 antibody: synthetic peptide directed towards the N terminal of human MORF4L1. Synthetic peptide located within the following region: KDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 37 kDa |
Gene Name | mortality factor 4 like 1 |
Database Link | |
Background | MORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation. |
Synonyms | Eaf3; FWP006; HsT17725; MEAF3; MORFRG15; MRG15; S863-6 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |