MRG15 (MORF4L1) (NM_006791) Human Recombinant Protein
CAT#: TP300251
Recombinant protein of human mortality factor 4 like 1 (MORF4L1), transcript variant 1, 20 µg
View other "MRG15" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200251 protein sequence
Red=Cloning site Green=Tags(s) MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL QKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARV DPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNK EYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLD EKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006782 |
| Locus ID | 10933 |
| UniProt ID | Q9UBU8 |
| Refseq Size | 1894 |
| Cytogenetics | 15q25.1 |
| Refseq ORF | 969 |
| Synonyms | Eaf3; FWP006; HsT17725; MEAF3; MORFRG15; MRG15; S863-6 |
| Summary | Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402027 | MORF4L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404237 | MORF4L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402027 | Transient overexpression lysate of mortality factor 4 like 1 (MORF4L1), transcript variant 1 |
CNY 3080.00 |
|
| LY404237 | Transient overexpression lysate of mortality factor 4 like 1 (MORF4L1), transcript variant 2 |
CNY 3080.00 |
|
| PH300251 | MORF4L1 MS Standard C13 and N15-labeled recombinant protein (NP_006782) |
CNY 19520.00 |
