DAP13 (NDUFA12) Rabbit Polyclonal Antibody

CAT#: TA330695

Rabbit Polyclonal Anti-NDUFA12 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 (NDUFA12)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 (NDUFA12), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 (NDUFA12), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-NDUFA12 antibody is: synthetic peptide directed towards the N-terminal region of Human NDUFA12. Synthetic peptide located within the following region: VLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 15 kDa
Gene Name NADH:ubiquinone oxidoreductase subunit A12
Background This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants.
Synonyms B17.2; DAP13
Note Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 91%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...