DACH2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DACH2 antibody: synthetic peptide directed towards the C terminal of human DACH2. Synthetic peptide located within the following region: TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	dachshund family transcription factor 2
Database Link	NP_444511 Entrez Gene 93837 MouseEntrez Gene 117154 Human UniProt ID Q96NX9
Background	Most X autosome translocations associated with premature ovarian failure do not interrupt X-linked genes. Only one of the six breakpoints disrupts the DACH2 gene.
Synonyms	FLJ31391; MGC138545
Note	Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Dog: 92%; Bovine: 92%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.