ASCL1 Rabbit Polyclonal Antibody

CAT#: TA330315

Rabbit Polyclonal Anti-ASCL1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of achaete-scute complex homolog 1 (Drosophila) (ASCL1)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human achaete-scute complex homolog 1 (Drosophila) (ASCL1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human achaete-scute complex homolog 1 (Drosophila) (ASCL1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ASCL1 antibody: synthetic peptide directed towards the middle region of human ASCL1. Synthetic peptide located within the following region: AGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNW
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 25 kDa
Gene Name achaete-scute family bHLH transcription factor 1
Background ASCL1 may play a role at early stages of development of specific neural lineages in most regions of the CNS, and of several lineages in the PNS. ASCL1 is essential for the generation of olfactory and autonomic neurons. ASCL1 activates transcription by binding to the E box (5'-CANNTG-3').This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms ASH1; bHLHa46; HASH1; MASH1
Note Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...