ASCL1 (NM_004316) Human Recombinant Protein
CAT#: TP301123
Recombinant protein of human achaete-scute complex homolog 1 (Drosophila) (ASCL1), 20 µg
View other "ASCL1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201123 protein sequence
Red=Cloning site Green=Tags(s) MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAA DGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFAT LREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVS SYSSDEGSYDPLSPEEQELLDFTNWF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004307 |
| Locus ID | 429 |
| UniProt ID | P50553 |
| Refseq Size | 2490 |
| Cytogenetics | 12q23.2 |
| Refseq ORF | 708 |
| Synonyms | ASH1; bHLHa46; HASH1; MASH1 |
| Summary | This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401374 | ASCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401374 | Transient overexpression lysate of achaete-scute complex homolog 1 (Drosophila) (ASCL1) |
CNY 3080.00 |
|
| PH301123 | ASCL1 MS Standard C13 and N15-labeled recombinant protein (NP_004307) |
CNY 19520.00 |
