TFIIE alpha (GTF2E1) Rabbit Polyclonal Antibody

CAT#: TA330103

Rabbit Polyclonal Anti-GTF2E1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GTF2E1 antibody: synthetic peptide directed towards the N terminal of human GTF2E1. Synthetic peptide located within the following region: DHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFC
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 49 kDa
Gene Name general transcription factor IIE subunit 1
Background GTF2E1 belongs to the TFIIE alpha subunit family. It recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.
Synonyms FE; TF2E1; TFIIE-A
Note Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 100%; Mouse: 92%; Rat: 92%
Reference Data
Protein Families Transcription Factors
Protein Pathways Basal transcription factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...