TXNRD1 (NM_003330) Human Recombinant Protein
CAT#: TP760704
Purified recombinant protein of Human thioredoxin reductase 1 (TXNRD1), transcript variant 1, (Note, selenocysteine protein, internal stop codon, see reference data summary), with N-terminal HIS tag, expressed in E.Coli, 50ug
View other "TXNRD1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 2040.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MSCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIII
GGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGW
KVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFL
IATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGF
DQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTR
KIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYE
NVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGF
HVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGC
|
| Tag | N-His |
| Predicted MW | 60.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, pH 8.0, 150 mM NaCl, 1% sarkosyl, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003321 |
| Locus ID | 7296 |
| UniProt ID | Q16881 |
| Refseq Size | 4206 |
| Cytogenetics | 12q23.3 |
| Refseq ORF | 1497 |
| Synonyms | GRIM-12; TR; TR1; TRXR1; TXNR |
| Summary | The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes an ubiquitously expressed, cytosolic form of TrxR, which functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing, primarily at the 5' end, results in transcript variants encoding same or different isoforms, including a glutaredoxin-containing isoform that is predominantly expressed in testis. [provided by RefSeq, May 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| PH316045 | TXNRD1 MS Standard C13 and N15-labeled recombinant protein (NP_877393) |
CNY 19520.00 |
|
| TP316045 | Recombinant protein of human thioredoxin reductase 1 (TXNRD1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP761190 | Purified recombinant protein of Human thioredoxin reductase 1 (TXNRD1), transcript variant 4, (Note, selenocysteine protein, internal stop codon, see reference data summary), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
