Recombinant TNF beta (Tumor necrosis factor beta), Mouse
CAT#: TP728373L
Recombinant TNF beta (Tumor necrosis factor beta), Mouse
|
Need it in bulk or customized? Get a free quote |
CNY 22000.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL with polyhistidine tag at the N-terminus.
|
| Tag | His Tag (N-term) |
| Predicted MW | The protein has a calculated MW of 19.36 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce cytotoxicity in L929 cells in the presence of vactinomycin D. The ED₅₀ for this effect is <30 ng/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P09225 |
| Synonyms | TNFSF1B, Lymphotoxin-alpha (LT-α), LTalpha, Ltx, TNF-be, TNFSF1, Tnf, Tnfb, Tnfsf, Tnfsf1b, Tnlg1e, hlb38, hlb382, lymph |
| Summary | Tumor Necrosis Factor Beta (TNF beta) or lymphotoxin-alpha (LT-α) is a 19 kDa tumor necrosis factor family protein with 171 amino acid residues. TNF beta is mainly expressed from lymphocytes, and mediates variety of inflammatory, immunostimulatory, and antiviral responses. TNF beta also involves development in secondary lymphoid organs. It is cytotoxic for different tumor cells in vitro and in vivo. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
